Recombinant Human Brain-Derived Neurotrophic Factor (rhBDNF)

Product Information

Part Number: GF002

Product Name: Brain-Derived Neurotrophic Factor

Synonyms: BDNF, Abrineurin

Quantity: 100 µg

Description

Brain-derived neurotrophic factor (BDNF) is a member of the neurotrophin family of growth factors, which also includes nerve growth factor (NGF), neurotrophin-3 (NT-3), and neurotrophin-4/5 (NT-4/5). BDNF plays an essential role in the survival, differentiation, and maintenance of neuronal populations in both the central and peripheral nervous systems. It is widely expressed in the brain, particularly in the hippocampus, cortex, and cerebellum.

BDNF promotes neuronal survival, neurite outgrowth, synaptic plasticity, and neuronal differentiation. Its biological effects are mediated primarily through activation of the TrkB receptor tyrosine kinase, which initiates intracellular signaling pathways involved in neuronal growth and survival.Alterations in BDNF expression or signaling have been associated with several neurological disorders, including neurodegenerative diseases and mood disorders.

Source

Recombinant protein produced in Escherichia coli (E. coli).

The recombinant protein contains a C-terminal spacer peptide (4 aa) followed by a six

histidine tag (6×His).

Molecular Characteristics

Protein length: 131 amino acids

Calculated molecular weight: 14,807 Da

SDS-PAGE migration: Approximately 15 kDa under both reducing (DTT) and non-reducing conditions.

Product Specifications

Concentration: 1 mg/mL after reconstitution in 100 µL sterile water

Purity: ≥97% (SDS-PAGE)

Endotoxin Level: <0.1 EU/µg protein (Pyrosate® Kit; Associates of Cape Cod)

Reconstitution

Reconstitute the lyophilized protein with 100 µL sterile water.

Further dilutions should be prepared using medium containing 5% fetal bovine serum (FBS).

Shipping

Shipped at ambient temperature.

Storage

Store at 2–8 °C.

For long-term storage, keep at −20 °C.

Handling

Avoid repeated freeze–thaw cycles.

After reconstitution, prepare aliquots and store at −20 °C.

Quality Control

Biological Activity

The biological activity of recombinant human BDNF can be determined using cell-based assays that measure TrkB receptor activation.

Common bioassays include:

• Cell proliferation assays using BaF3 cells engineered to express TrkB

• Neuronal survival assays

• Neurite outgrowth assays in primary neuronal cultures

These assays evaluate the ability of BDNF to activate TrkB-mediated signaling pathways that promote neuronal survival and differentiation.

Amino Acid Sequence (131 aa)

MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGRNGGGGHHHHHH