Recombinant Canine Vascular Endothelial Growth Factor 120 (rcVEGF120)

Product Information

Part Number: GF002

Product Name: Canine Vascular Endothelial Growth Factor 120

Synonyms: VEGF-A, Vascular Endothelial Growth Factor A, VEGF120

Quantity: 100 µg

Description

Vascular endothelial growth factor (VEGF) is a key regulator of angiogenesis and vasculogenesis. It belongs to a family of secreted growth factors that stimulate the proliferation, migration, and survival of endothelial cells.

VEGF exerts its biological activity through binding to VEGF receptor tyrosine kinases (VEGFR-1/Flt-1 and VEGFR-2/KDR) located on endothelial cells. Activation of these receptors triggers intracellular signaling pathways including MAPK, PI3K/AKT, and PLCγ, leading to endothelial cell proliferation, vascular permeability, and formation of new blood vessels.

VEGF is essential for vascular development, wound healing, and tissue regeneration, and dysregulated VEGF signaling is implicated in tumor angiogenesis and inflammatory diseases.

Multiple isoforms of VEGF exist due to alternative splicing, including VEGF121, VEGF165, and VEGF189 in humans. The canine VEGF120 isoform represents the shorter soluble form lacking heparin-binding domains, resulting in increased diffusibility in the extracellular environment.

Source

Produced in Escherichia coli (E. coli).

The recombinant canine VEGF120 protein contains a C-terminal spacer peptide (2 aa) followed by a six-histidine tag (6×His) to facilitate purification.

Molecular Characteristics

Protein length: 129 amino acids

Calculated molecular weight: 15,117 Da. VEGF proteins naturally form disulfide-linked homodimers. After refolding, the recombinant protein is predominantly present in the dimeric form, although SDS-PAGE analysis may reveal both monomeric (~15 kDa) and dimeric (~30 kDa) species even under reducing conditions.

Product Specifications

Quantity: 100 µg

Formulation: Lyophilized from PBS

Purity: ≥96% (SDS-PAGE)

Reconstitution

Reconstitute the lyophilized protein with sterile water.

Further dilutions should be prepared using medium containing 5% fetal bovine serum (FBS).

Shipping

Shipped at ambient temperature.

Storage

Store at 2–8 °C. For long-term storage, keep at −20 °C.

Handling

Avoid repeated freeze–thaw cycles.

After reconstitution, prepare aliquots and store at −20 °C.

Quality Control

Purity

≥96% as determined by SDS-PAGE under reducing conditions.

Biological Activity

The biological activity of recombinant VEGF is determined using a cell proliferation assay with endothelial cells, typically human umbilical vein endothelial cells (HUVEC). In this assay, VEGF stimulates proliferation of endothelial cells in a dose-dependent manner, and activity is quantified by measuring cell growth relative to untreated controls. This endothelial cell proliferation assay is widely used as a standard functional test for VEGF bioactivity, reflecting activation of VEGF receptor signaling pathways.

Amino Acid Sequence (129 aa)

MAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKCDKPRRGGHHHHHH