Comercializadora Centro de Biotecnología y Biomedicina Ltda.

Recombinant Bovine Prolactin (rbPRL)

$200.00 USD

Product Information

Part Number: H001

Product Name: Bovine Prolactin

Synonyms: PRL, Prolactin, Lactotropin, Luteotropic Hormone

Quantity: 50 µg

Description

Prolactin (PRL) is a pituitary peptide hormone of the somatotropin/prolactin family that plays a central role in the regulation of mammary gland development and lactation. In addition to its classical lactogenic function, prolactin is involved in reproduction, growth, development, and osmoregulatory and immunomodulatory processes. 

Prolactin exerts its biological effects through binding to the prolactin receptor (PRLR), a class I cytokine receptor, leading to activation of intracellular signaling pathways that include JAK2/STAT5 and that regulate proliferation, differentiation, and hormone-responsive gene expression. 

Source

Produced in Escherichia coli (E. coli).

The recombinant protein contains a C-terminal spacer peptide (4 aa) followed by a six-histidine tag (6×His) to facilitate purification.

Molecular Characteristics

Protein length: 243 amino acids

Calculated molecular weight: 27,332 Da

Product Specifications

Quantity: 100 µg

Formulation: Lyophilized from PBS

Purity: ≥93% (SDS-PAGE)

Reconstitution

Reconstitute the lyophilized protein with sterile water.

Further dilutions should be prepared using medium containing 5% fetal bovine serum (FBS).

Shipping

Shipped at ambient temperature.

Storage

Store at 2–8 °C.

For long-term storage, keep at −20 °C.

Handling

Avoid repeated freeze–thaw cycles.

After reconstitution, prepare aliquots and store at −20 °C.

Quality Control

Purity

≥93% as determined by SDS-PAGE under reducing conditions.

Biological Activity

The biological activity of recombinant bovine prolactin is determined using a cell proliferation assay with Nb2-11 rat lymphoma cells. In this assay, prolactin stimulates proliferation of Nb2-11 cells in a dose-dependent manner, and activity is quantified by measuring cell growth relative to untreated controls. Nb2/Nb2-11 cells are a well-established bioassay system for lactogenic hormones such as prolactin, and this assay is widely used in the literature and by cell repositories for prolactin bioactivity testing. 

Specific activity / ED50: To avoid overstatement, this should be determined experimentally for the final recombinant bovine construct and lot. Commercial recombinant prolactin products from other species often report Nb2-11-based ED50 values, but those values should not be assigned directly to this bovine construct without in-house testing. 

Amino Acid Sequence (243 aa)

MKETAAAKFERQHMDSPDLGTLVPRGSMADIGSTPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNCSGGGGHHHHHH

 

Free shipping
Safe purchase
International shipping
Secure returns up to 30 days