Comercializadora Centro de Biotecnología y Biomedicina Ltda.

Recombinant Human Epidermal Growth Factor (rhEGF)

$200.00 USD

Product Information

Part Number: GF001
Product Name: Epidermal Growth Factor
Synonyms: EGF, Epidermal Growth Factor, Urogastrone, URG
Quantity: 200 µg

Description

Epidermal growth factor (EGF) is expressed as a transmembrane protein that is proteolytically cleaved to generate soluble forms. EGF signals through the EGF receptor (EGFR/ErbB1), which can heterodimerize with ErbB2, ErbB3, or ErbB4, and may also associate with PDGF receptor beta and HGF receptor (c-MET). During development, EGF regulates thymocyte differentiation, neuroglia production, and adipocyte maturation. In the adult organism, EGF plays roles in mammary gland lactogenesis, fibroblast mitosis, dissociation of the extracellular matrix, and cell migration.

Source

Produced in Pichia pastoris.

The recombinant protein corresponds to the active domain of human EGF (aa 971–1023) fused at its C-terminus to six additional arginine residues.

Molecular Characteristics

Protein length: 59 amino acids
Calculated molecular weight: 7,159.14 Da
Isoelectric point (pI): 8.30

GenBank Accession: AAH93731.1

Product Specifications

Concentration: 1.0 mg/mL after reconstitution in 100 µL sterile water

Formulation: Lyophilized from sterile PBS, pH 7.4

Purity: ≥97% (SDS-PAGE)

Endotoxin Level: <0.1 EU/µg protein (Pyrosate® Kit; Associates of Cape Cod)

Reconstitution

Reconstitute the lyophilized protein with 100 µL sterile water.

Further dilutions should be prepared using culture medium containing 5% fetal bovine serum (FBS).

Shipping

Shipped at ambient temperature.

Storage

Store at 2–8 °C.

For long-term storage, keep at −20 °C.

Handling

Avoid repeated freeze–thaw cycles.

After reconstitution, prepare aliquots and store at −20 °C.

Quality Control

Purity

97% as determined by SEC-HPLC.

Biological Activity

The biological activity of human EGF is defined by its Median Effective Dose (ED50), determined through a dose-dependent mitogenic activity assay using BALB/c 3T3 cells.

Historical batches have shown an ED50 activity ≤ 0.1 ng/mL.

Amino Acid Sequence (59 aa)

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRRRRRRR

 

Free shipping
Safe purchase
International shipping
Secure returns up to 30 days