Comercializadora Centro de Biotecnología y Biomedicina Ltda.

Recombinant Human Interferon Gamma (rhIFN-γ)

$320.00 USD

Product Information

Part Number: I002
Product Name: Interferon Gamma
Synonyms: IFN-γ, Interferon gamma, IFNG
Quantity: 100 µg

Description

Interferon gamma (IFN-γ) is a secreted protein belonging to the type II interferon family. It is produced predominantly by NK and NKT cells as part of the innate immune response, and by CD4⁺ T helper cells and CD8⁺ cytotoxic T lymphocytes after the development of antigen-specific immunity.

IFN-γ exhibits antiviral, immunoregulatory, and antitumor properties. In addition to its antiviral activity, IFN-γ plays important immunoregulatory roles. It is a potent activator of macrophages, exerts antiproliferative effects on transformed cells, and can enhance the antiviral and antitumor activities of type I interferons.

IFN-γ is critical for both innate and adaptive immunity, particularly in host defense against:

  • Viral infections

  • Intracellular bacterial infections

  • Tumor development and progression

Source

Recombinant protein produced in Escherichia coli (E. coli).

The recombinant human IFN-γ corresponds to the extracellular domain (aa 24–166) fused at its C-terminus to a short spacer peptide (4 aa) and a six-histidine tag (6×His) for purification.

Molecular Characteristics

Protein length: 154 amino acids
Calculated molecular weight: 17,958 Da
SDS-PAGE migration: Approximately 18 kDa under both reducing (DTT) and non-reducing conditions

Product Specifications

Concentration: 1.0 mg/mL after reconstitution in 100 µL sterile water

Formulation: Lyophilized from sterile PBS, pH 7.4

Purity: ≥97% (SDS-PAGE)

Endotoxin Level: <0.1 EU/µg protein (Pyrosate® Kit; Associates of Cape Cod)

Reconstitution

Reconstitute the lyophilized protein with 100 µL sterile water.

Further dilutions should be prepared using culture medium containing 5% fetal bovine serum (FBS).

Shipping

Shipped at ambient temperature.

Storage

Store at 2–8 °C.

For long-term storage, keep at −20 °C.

Handling

Avoid repeated freeze–thaw cycles.

After reconstitution, prepare aliquots and store at −20 °C.

Quality Control

Purity

≥97% as determined by SDS-PAGE under reducing conditions and visualized by silver staining.

Biological Activity

The antiviral activity of IFN-γ is determined by measuring its ability to prevent infection and cytopathic destruction of HEp-2 cells (human laryngeal carcinoma cell line, ATCC No. CCL-23) by Mengo virus.

The specific activity of IFN-γ is approximately: 2 × 10⁷ IU/mg, when calibrated against the WHO International Standard for IFN-γ (Gxg 01-902-535).  

Amino Acid Sequence (154 aa)

MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGHHHHHH

 

Envío gratis
Compra segura
Envíos internacionales
Devoluciones seguras hasta 30 días