Comercializadora Centro de Biotecnología y Biomedicina Ltda.
Recombinant Human Interleukin-4 (rhIL-4)
Product Information
Part Number: C004
Product Name: Interleukin-4
Synonyms: Interleukin-4, BCGF-1, BCGF1, BSF-1, BSF1, IL-4
Quantity: 100 µg
Description
Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates various T-cell and B-cell responses, including the differentiation of naïve T cells into the TH2 phenotype, promoting B-cell proliferation, antibody isotype switching, and the expression of other TH2 cytokines, including IL-5 and IL-9. IL-4 plays a key role in the development of allergic inflammation and asthma.
Source
Produced in Escherichia coli (E. coli). The recombinant protein contains a C-terminal spacer peptide (4 aa) and a six-histidine tag (6×His).
Molecular Characteristics
Protein length: 140 amino acids
Calculated molecular weight: 16,145 Da
SDS-PAGE migration: Approximately 16 kDa under both reducing (DTT) and non-reducing conditions
GenBank Accession: AAA59149.1
Product Specifications
Concentration: 1 mg/mL after reconstitution in 100 µL sterile water
Formulation: Lyophilized from 50 mM phosphate buffer, pH 7.4
Purity: ≥90% (SDS-PAGE)
Endotoxin Level: <0.1 EU/µg protein (Pyrosate® Kit; Associates of Cape Cod)
Reconstitution
Reconstitute the lyophilized protein with 100 µL sterile water.
Further dilutions should be prepared using medium containing 5% fetal bovine serum (FBS).
Shipping
Shipped at ambient temperature.
Storage
Store at 2–8 °C.
For long-term storage, keep at −20 °C.
Handling
Avoid repeated freeze–thaw cycles.
After reconstitution, prepare aliquots and store at −20 °C.
Quality Control
Purity
90% as determined by SDS-PAGE under reducing conditions and visualized by Coomassie Blue staining.
Biological Activity
The IC50 value (i.e., the concentration of cytotoxic agent required to reduce cell growth by 50%) for rhIL-4 is determined in a bioassay using human TF-1 cells. Historical lots have shown an IC50 activity in the concentration range of: 1–5 ng/mL
Amino Acid Sequence (140 aa)
MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSGGGGHHHHHH