Comercializadora Centro de Biotecnología y Biomedicina Ltda.

Recombinant Human Interleukin-4 (rhIL-4)

$650.00 USD

Product Information

Part Number: C004
Product Name: Interleukin-4
Synonyms: Interleukin-4, BCGF-1, BCGF1, BSF-1, BSF1, IL-4
Quantity: 100 µg

Description

Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates various T-cell and B-cell responses, including the differentiation of naïve T cells into the TH2 phenotype, promoting B-cell proliferation, antibody isotype switching, and the expression of other TH2 cytokines, including IL-5 and IL-9. IL-4 plays a key role in the development of allergic inflammation and asthma.

Source

Produced in Escherichia coli (E. coli). The recombinant protein contains a C-terminal spacer peptide (4 aa) and a six-histidine tag (6×His).

Molecular Characteristics

Protein length: 140 amino acids
Calculated molecular weight: 16,145 Da
SDS-PAGE migration: Approximately 16 kDa under both reducing (DTT) and non-reducing conditions

GenBank Accession: AAA59149.1

Product Specifications

Concentration: 1 mg/mL after reconstitution in 100 µL sterile water

Formulation: Lyophilized from 50 mM phosphate buffer, pH 7.4

Purity: ≥90% (SDS-PAGE)

Endotoxin Level: <0.1 EU/µg protein (Pyrosate® Kit; Associates of Cape Cod)

Reconstitution

Reconstitute the lyophilized protein with 100 µL sterile water.

Further dilutions should be prepared using medium containing 5% fetal bovine serum (FBS).

Shipping

Shipped at ambient temperature.

Storage

Store at 2–8 °C.

For long-term storage, keep at −20 °C.

Handling

Avoid repeated freeze–thaw cycles.

After reconstitution, prepare aliquots and store at −20 °C.

Quality Control

Purity

90% as determined by SDS-PAGE under reducing conditions and visualized by Coomassie Blue staining.

Biological Activity

The IC50 value (i.e., the concentration of cytotoxic agent required to reduce cell growth by 50%) for rhIL-4 is determined in a bioassay using human TF-1 cells. Historical lots have shown an IC50 activity in the concentration range of: 1–5 ng/mL

Amino Acid Sequence (140 aa)

MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSGGGGHHHHHH

 

Envío gratis
Compra segura
Envíos internacionales
Devoluciones seguras hasta 30 días